PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019268
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family Trihelix
Protein Properties Length: 697aa    MW: 77353.6 Da    PI: 7.5846
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019268genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix54.62.8e-17620684165
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkik 65 
                +W+ +e+++Li++r e++ r++ ++ +++lWee+s+ m++ g++rsp qCk+ w +l ++++ + 
  Cla019268 620 KWKPEEIKKLIKLRGELHARFQVARGRMALWEEISNGMSADGINRSPGQCKSLWASLVQKFEVCS 684
                7************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.107.7E-6837287IPR001279Metallo-beta-lactamase
SuperFamilySSF562812.23E-5838367IPR001279Metallo-beta-lactamase
SMARTSM008492.0E-2450247IPR001279Metallo-beta-lactamase
PfamPF127069.9E-1162197IPR001279Metallo-beta-lactamase
PROSITE profilePS500907.909613677IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.0E-5615679IPR009057Homeodomain-like
PfamPF138371.5E-12618683No hitNo description
CDDcd122031.22E-21619681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009942Biological Processlongitudinal axis specification
GO:0060918Biological Processauxin transport
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
SKVPRKRPGR LEGARRSMED SVQRKMEQFY EGSDGPPLRV LPIGGLGEIG MNCMLVGNYD  60
RYILIDAGVM FPDHDELGVQ KIIPDTTFIK RWSHKIEAVV ITHGHEDHIG ALPWVIPALD  120
SHTPIYASSF TVELIKKRLK ENGIFVPSRL KVFKMKKRFT AGPFEIEPIR VTHSIPDCCG  180
LVLRCADGII LHTGDWKIDE SPLDGKVFDR ETLEELSKEG VTLMMSDSTN VLSPGRTISE  240
SVVADALLRR ISAAKGRVIT TQFASNIHRL GSVKAAADLT GRKLVFVGMS LRTYLDAAWK  300
DGKAPIDPST LVKVEDIDAY APKDLLIVTT GSQAEPRAAL NLASYGSSHS LKLSKEDMIL  360
YSAKPFCFEL QTPLPPMWDY LVMEILRPQS VDGSNETGIR GKLRITTRCL WLDKGKLLDA  420
LHKAAHAALS SCPVNCPLAH MERTVAELLR KMVRKYSGKR PEVIVMAVEN PGGVLSEELG  480
ARLSGKSNTG FGMSALRKAV DGQPTKSHVN STRPDGNDDL HSEESQGYYL EPGRLLPEDD  540
YDTSSSNLTE TQSFDNEGLE DFWRPFITPS SPAKELAKDN EGSVQQSKNM LEITNEREEV  600
SDDKSLKTSN SDVKPLKRNK WKPEEIKKLI KLRGELHARF QVARGRMALW EEISNGMSAD  660
GINRSPGQCK SLWASLVQKF EVCSSVSTFN FELALPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a0v_B7e-633836319340RIBONUCLEASE J
5a0v_A7e-633836319340RIBONUCLEASE J
5a0t_B7e-633836319340RIBONUCLEASE J
5a0t_A7e-633836319340RIBONUCLEASE J
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866975.10.0PREDICTED: uncharacterized protein LOC107404538
TrEMBLA0A0A0LRV70.0A0A0A0LRV7_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000394190.0(Solanum tuberosum)
STRINGPOPTR_0012s09780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50993450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein